PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600535.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 924aa    MW: 103382 Da    PI: 6.064
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600535.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.31.8e-29608659152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+l+ l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_009600535.1 608 AEKNITLQILQQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 659
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.733598679IPR003035RWP-RK domain
PfamPF020421.3E-25611659IPR003035RWP-RK domain
SuperFamilySSF542771.45E-22819907No hitNo description
PROSITE profilePS5174524.246826909IPR000270PB1 domain
SMARTSM006662.0E-21826909IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.5E-21827904No hitNo description
PfamPF005643.8E-17828905IPR000270PB1 domain
CDDcd064074.97E-36828905No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 924 aa     Download sequence    Send to blast
MSMDERLVVT NTFLTTQFDS FMDLDYMDEL LLEGCFLETI DDREFAHHRP SISNMPFDSS  60
FVWPTLLDTN DVEFSGSPSK DGQQERQRLS FSKNLSVSQF QELNSVKVQS FGENSINAMC  120
SSGQSDCLFD APELSRRWWI GPNDSSSVMD RLIQALGYIK NCSKDKDILI QIWVPIYRDG  180
KRVLSTNDQP FSLDLNCPRL AHYRQASLNY QFPANDDSKE MVGLPGRVFL DKVPEWTPDV  240
QFFQMEEYPR VGHAQQYNVR GTLAVPVFEQ GSRNCLSVIE VVRTTQKIKY SSELESVCKA  300
LEAVDLRSSE VSSTLTAKAC DLTYQAALSE ILEVLKSACK THGLPLAQTW VPCIQHGKGG  360
SRHSNENLIH CVSTEDSACY VADPRVQGFH EACSEHHLLK GQGVVGSAFM TNQPCFTADL  420
TSYSKAEYPL SHYARMFGLH AAVAIRLRSM STGSSDFVLE FFLPPNCRNP EEHKRMLTSL  480
SIIIQNVCQT FRVVSDKELQ DETVSLGEVT SVAASEYSEE VREQERKGSI VSSQERTSWT  540
SSHEEVQETS SVVSAFQDEL LTEEPVALRN QTNSGSATAF AFSRNYRTAG EGISHNWRKA  600
RDRRRLKAEK NITLQILQQY FAGSLKDAAK SIGVCPTTLK RICRQHGIQR WPSRKIKKVG  660
LSLERIQRVI NSVQGVSGTL QIESFYSDFP EFASSNISRS SPFADPTPTN HPEDLNRQPE  720
SGGNNAATSK SVSSSCSQGS SSSQRSIGTQ PHPYPSNVAG HEDPVAEEAS DNHALKRVNS  780
DAELHLSSEA LNPQPRSQSH ASLTESPKSV SLSPMKKSLE RSQEGAPRIK VIHGEEKIRF  840
RIQKNWGYKE LMREIARRFG VDDPSGFHLK YLDDDSDWVL LTCEADLEEC IDVCWSSQNK  900
MIRLLFLCDS QPHLGSSFGS SSSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600534.10.0PREDICTED: protein NLP5-like
RefseqXP_009600535.10.0PREDICTED: protein NLP5-like
RefseqXP_016442216.10.0PREDICTED: protein NLP5-like
RefseqXP_016442217.10.0PREDICTED: protein NLP5-like
RefseqXP_016442218.10.0PREDICTED: protein NLP5-like
TrEMBLM1ALT30.0M1ALT3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000256570.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein